missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclin E1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-88153
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Cyclin E1 Polyclonal antibody specifically detects Cyclin E1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Spezifikation
| Cyclin E1 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| CCNEcyclin Es, cyclin E1, cyclin Et, G1/S-specific cyclin-E1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPD | |
| 0.1 mL | |
| Cancer, Cell Cycle and Replication, Cellular Markers, Ovarian Carcinoma Cell Markers | |
| 898 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction