missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Enteropeptidase/Enterokinase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-62679
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Enteropeptidase/Enterokinase Polyclonal antibody specifically detects Enteropeptidase/Enterokinase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| Enteropeptidase/Enterokinase | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| EC 3.4.21, EC 3.4.21.9, Enterokinase, ENTKenterokinase, MGC133046, protease, serine, 7 (enterokinase), PRSS7enteropeptidase, Serine protease 7, Transmembrane protease serine 15, transmembrane protease, serine 15 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK | |
| 100 μg | |
| Epitope Tags, Immunology, Innate Immunity | |
| 5651 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur