missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ epithelial Sodium Channel beta Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP1-84844PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCNN1B. The epithelial Sodium Channel beta Recombinant Protein Antigen is derived from E. coli. The epithelial Sodium Channel beta Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-84844. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Spezifikation
| 6338 | |
| Chromatography | |
| 0.5mg/mL | |
| PBS and 1M Urea, pH 7.4. | |
| SCNN1B | |
| 34kDa | |
| 0.1mL | |
| E.Coli | |
| GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS |
| Human | |
| >80% | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| Unmarkiert | |
| epithelial Sodium Channel beta | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84844. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Nur für Forschungszwecke