missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fc gamma RIIA/CD32a Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
316.00 € - 554.00 €
Spezifikation
| Antigen | Fc gamma RIIA/CD32a |
|---|---|
| Verdünnung | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18456140
|
Novus Biologicals
NBP1-84589-25ul |
25 μL |
316.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18497030
|
Novus Biologicals
NBP1-84589 |
0.1 mL |
554.00 €
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Fc gamma RIIA/CD32a Polyclonal antibody specifically detects Fc gamma RIIA/CD32a in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| Fc gamma RIIA/CD32a | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2212 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD32 antigen, CD32A, CD32MGC23887, CDw32fc-gamma-RIIa, Fc fragment of IgG, low affinity IIa, receptor (CD32), Fc fragment of IgG, low affinity IIa, receptor for (CD32), FCG2, Fc-gamma RII-a, Fc-gamma-RIIa, FcGR, FCGR2, FCGR2A1, FcRII-a, IGFR2MGC30032, IgG Fc receptor II-a, Immunoglobulin G Fc receptor II, low affinity immunoglobulin gamma Fc region receptor II-a | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts