missing translation for 'onlineSavingsMsg'
Learn More
Learn More
glycerol-3-phosphate permease Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 572.00 €
Spezifikation
| Antigen | glycerol-3-phosphate permease |
|---|---|
| Verdünnung | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18482232
|
Novus Biologicals
NBP1-87524-25ul |
25 μL |
280.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18259006
|
Novus Biologicals
NBP1-87524 |
0.1 mL |
572.00 €
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
glycerol-3-phosphate permease Polyclonal specifically detects glycerol-3-phosphate permease in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| glycerol-3-phosphate permease | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 54020 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ22340, G-3-P permease, G-3-P transporter, G3PPgene similar to glycerol-3-phosphate permease10Glycerol-3-phosphate permease, glycerol-3-phosphate transporter, solute carrier family 37 (glycerol-3-phosphate transporter), member 1, Solute carrier family 37 member 1 | |
| SLC37A1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts