missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ GSTZ1 (Human) Recombinant Protein

Human GSTZ1 full-length ORF ( AAH01453, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00002954-P01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16185851

  • 467.00 € / 25 Mikrogramm

Verfügbar ab
22-12-2020

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Spezifikation

Spezifikation

AAH01453
glutathione transferase zeta 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GSTZ1
GST
2954
Wheat germ expression system
25 μg
GSTZ1-1, MAAI, MAI, MGC2029
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation