missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIF-2 alpha/EPAS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 456.00 €
Spezifikation
| Antigen | HIF-2 alpha/EPAS1 |
|---|---|
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18220593
|
Novus Biologicals
NBP2-58653 |
100 μL |
456.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18605247
|
Novus Biologicals
NBP2-58653-25ul |
25 μL |
302.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
HIF-2 alpha/EPAS1 Polyclonal specifically detects HIF-2 alpha/EPAS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| HIF-2 alpha/EPAS1 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Apoptosis, Cancer, Cancer Stem Cells, Chromatin Research, Embryonic Stem Cell Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Transcription Factors and Regulators | |
| Basic-helix-loop-helix-PAS protein MOP2, BHLHE73, Class E basic helix-loop-helix protein 73, ECYT4, endothelial PAS domain protein 1, endothelial PAS domain-containing protein 1, EPAS1, EPAS-1, HIF-1-alpha-like factor, HIF-1alpha-like factor, HIF-2 alpha, | |
| EPAS1 | |
| IgG | |
| Affinity Purified | |
| 96.5 kDa |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 2034 | |
| This HIF-2 alpha/EPAS1 Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG | |
| Primary | |
| The specificity of this HIF-2 alpha/EPAS1 Antibody was verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts