missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HLA-DRB4 (Human) Recombinant Protein
Human HLA-DRB4 full-length ORF ( AAH05312, 30 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.
Marque: Abnova™ H00003126-P01.25ug
Informations supplémentaires : Netto-Gewicht : 0.00010kg
Description
- Sequence: GDTQPRFLEQAKCECRFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
Spécification
| AAH05312 | |
| major histocompatibility complex, class II, DR beta 4 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HLA-DRB4 | |
| GST |
| 3126 | |
| Wheat germ expression system | |
| 25 μg | |
| DRB4, HLA-DR4B | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |