missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human AAMP Partial ORF (NP_001078.2, 111 a.a. - 210 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00000014-Q01.25ug
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
The gene product is an immunoglobulin-type protein. It is found to be expressed strongly in endothelial cells, cytotrophoblasts, and poorly differentiated colon adenocarcinoma cells found in lymphatics. The protein contains a heparin-binding domain and mediates heparin-sensitive cell adhesion. [provided by RefSeq]
Sequence: GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTSpezifikation
NP_001078.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT | |
RUO | |
AAMP | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
14 | |
AAMP (Human) Recombinant Protein (Q01) | |
25 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
AAMP | |
Wheat Germ (in vitro) | |
GST | |
Liquid |