missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AAMP Partial ORF (NP_001078.2, 111 a.a. - 210 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00000014-Q01.25ug

Weitere Details : Netto-Gewicht : 0.02000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16083585

  • 508.00 € / 25 Mikrogramm
Verfügbar ab: 04-04-2024
Sie sich ein, um den Lagerbestand zu sehen

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

The gene product is an immunoglobulin-type protein. It is found to be expressed strongly in endothelial cells, cytotrophoblasts, and poorly differentiated colon adenocarcinoma cells found in lymphatics. The protein contains a heparin-binding domain and mediates heparin-sensitive cell adhesion. [provided by RefSeq]

Sequence: GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT
Spezifikation

Spezifikation

NP_001078.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT
RUO
AAMP
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
14
AAMP (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AAMP
Wheat Germ (in vitro)
GST
Liquid
Empfehlungen

Empfehlungen

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote