missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FOXA1 Partial ORF (NP_004487, 367 a.a. - 472 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Spezifikation
Zugriffsnummer | NP_004487 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 3169 |
Molekulargewicht | 37.4kDa |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
16176261
|
Abnova™
H00003169-Q01.25UG |
25 ug |
508.00 €
25 Mikrogramm |
Verfügbar ab: 18-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
16166261
|
Abnova™
H00003169-Q01.10UG |
10 ug |
335.00 €
10 Mikrogramm |
Verfügbar ab: 18-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
Beschreibung
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. [provided by RefSeq]
Sequence: LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTSSpezifikation
NP_004487 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.4kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HNF3A/MGC33105/TCF3A | |
FOXA1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
3169 | |
FOXA1 (Human) Recombinant Protein (Q01) | |
LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS | |
RUO | |
FOXA1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |