missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human KUB3 Partial ORF (NP_150592, 152 a.a. - 246 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00091419-Q01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
Sequence: VRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNISpezifikation
| NP_150592 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.19kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI | |
| RUO | |
| XRCC6BP1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 91419 | |
| KUB3 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| KUB3/MGC134817/MGC134818 | |
| XRCC6BP1 | |
| Recombinant | |
| wheat germ expression system |