Learn More
Abnova™ Human RPRD1A Partial ORF (NP_060640, 76 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00055197-Q01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
P15RS is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) (CDKN2B; MIM 600431) and may have a role in cell cycle regulation (Liu et al., 2002 [PubMed 12470661]).[supplied by OMIM]
Sequence: EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALSpezifikation
NP_060640 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.19kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL | |
RUO | |
RPRD1A | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
55197 | |
RPRD1A (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ10656/HsT3101/MGC19513/P15RS | |
RPRD1A | |
Recombinant | |
wheat germ expression system |