Learn More
Abnova™ Human SOD2 Partial ORF (NP_000627, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Spezifikation
Zugriffsnummer | NP_000627 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 6648 |
Molekulargewicht | 37.84kDa |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
16195645
|
Abnova™
H00006648-Q01.25UG |
25 ug |
508.00 €
25 Mikrogramm |
Verfügbar ab: 25-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
16185645
|
Abnova™
H00006648-Q01.10UG |
10 ug |
335.00 €
10 Mikrogramm |
Verfügbar ab: 25-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
Beschreibung
This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]
Sequence: MLSRAVCGTSRQLPPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGSpezifikation
NP_000627 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.84kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
IPO-B/MNSOD/Mn-SOD | |
SOD2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
6648 | |
SOD2 (Human) Recombinant Protein (Q01) | |
MLSRAVCGTSRQLPPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGG | |
RUO | |
SOD2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |