missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SOS1 Partial ORF (NP_005624, 313 a.a. - 420 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Spezifikation
| Zugriffsnummer | NP_005624 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 6654 |
| Molekulargewicht | 37.62kDa |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16175675
|
Abnova™
H00006654-Q01.25UG |
25 ug |
508.00 €
25 Mikrogramm |
Verfügbar ab: 06-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
|
16165675
|
Abnova™
H00006654-Q01.10UG |
10 ug |
335.00 €
10 Mikrogramm |
Verfügbar ab: 06-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
Beschreibung
This gene encodes a protein that is a guanine nucleotide exchange factor for RAS proteins, membrane proteins that bind guanine nucleotides and participate in signal transduction pathways. GTP binding activates and GTP hydrolysis inactivates RAS proteins. The product of this gene may regulate RAS proteins by facilitating the exchange of GTP for GDP. Mutations in this gene are associated with gingival fibromatosis 1 and Noonan syndrome type 4. [provided by RefSeq]
Sequence: SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIKSpezifikation
| NP_005624 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.62kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GF1/GGF1/GINGF/HGF/NS4 | |
| SOS1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 6654 | |
| SOS1 (Human) Recombinant Protein (Q01) | |
| SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK | |
| RUO | |
| SOS1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |