missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TP53 Partial ORF (AAH03596, 94 a.a. - 201 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70 € - 518.16 €

Spezifikation

Name TP53 (Human) Recombinant Protein (Q01)
Rekombinant Yes
Zur Verwendung mit (Anwendung) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molekulargewicht 37.62kDa
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16176855
Unterlagen ansehen Aktionsdetails
Abnova™
H00007157-Q01.25UG
25 ug
518.16 €
25 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 24-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
16166855
Unterlagen ansehen Aktionsdetails
Abnova™
H00007157-Q01.10UG
10 ug
341.70 €
10 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 24-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Beschreibung

Beschreibung

This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity. [provided by RefSeq]

Sequence: SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNL
Spezifikation

Spezifikation

TP53 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
37.62kDa
Sicherheitsdatenblatt (SDS)
Produktzertifizierungen