missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TRIP6 Partial ORF (NP_003293, 51 a.a. - 148 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00 € - 508.00 €

Spezifikation

Zugriffsnummer NP_003293
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 7205
Molekulargewicht 36.52kDa
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16094915
Unterlagen ansehen Aktionsdetails
Abnova™
H00007205-Q02.25UG
25 ug
508.00 €
25 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab: 04-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
16084915
Unterlagen ansehen Aktionsdetails
Abnova™
H00007205-Q02.10UG
10 ug
335.00 €
10 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab: 04-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Beschreibung

Beschreibung

This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq]

Sequence: SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP
Spezifikation

Spezifikation

NP_003293
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC10556/MGC10558/MGC29959/MGC3837/MGC4423/OIP1/ZRP-1
TRIP6
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
7205
TRIP6 (Human) Recombinant Protein (Q02)
SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP
RUO
TRIP6
Wheat Germ (in vitro)
GST
Liquid
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Produktzertifizierungen