missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-12 R beta 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-57287
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
IL-12 R beta 1 Polyclonal specifically detects IL-12 R beta 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| IL-12 R beta 1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| CD212, CD212 antigen, IL-12 receptor beta component, IL-12 receptor subunit beta-1, IL12R, IL-12R subunit beta-1, IL12RB, IL-12RB1, IL-12R-beta-1, IL-12R-BETA1, interleukin 12 receptor, beta 1, interleukin-12 receptor beta-1 chain, interleukin-12 receptor subunit beta-1, MGC34454 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| IL12RB1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES | |
| 100 μL | |
| Cell Cycle and Replication | |
| 3594 | |
| Human | |
| IgG |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
For Research Use Only
Haben Sie Verbesserungsvorschläge?