missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-12 R beta 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 559.00 €
Spezifikation
| Antigen | IL-12 R beta 1 |
|---|---|
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18286222
|
Novus Biologicals
NBP2-57287 |
100 μL |
559.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18618326
|
Novus Biologicals
NBP2-57287-25ul |
25 μL |
369.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
IL-12 R beta 1 Polyclonal specifically detects IL-12 R beta 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| IL-12 R beta 1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| CD212, CD212 antigen, IL-12 receptor beta component, IL-12 receptor subunit beta-1, IL12R, IL-12R subunit beta-1, IL12RB, IL-12RB1, IL-12R-beta-1, IL-12R-BETA1, interleukin 12 receptor, beta 1, interleukin-12 receptor beta-1 chain, interleukin-12 receptor subunit beta-1, MGC34454 | |
| IL12RB1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 3594 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts