missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-18 BPa/IL18BP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marke: Novus Biologicals NBP2-38481-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
IL-18 BPa/IL18BP Polyclonal specifically detects IL-18 BPa/IL18BP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| IL-18 BPa/IL18BP | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| O95998 | |
| IL18BP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG | |
| 25 μL | |
| Cytokine Research, Immunology, Innate Immunity | |
| 10068 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| IL-18BP, IL18BPa, interleukin 18 binding protein, interleukin-18-binding protein, MC51L-53L-54L homolog gene product, tadekinig-alfa | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur