missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ IL1B (Human) Recombinant Protein (Q01)
Human IL1B partial ORF with GST-tag at N-terminal
Marke: Abnova™ H00003553-Q01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
- Theoretical MW: 36.63kDa
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Spezifikation
| AAH08678 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 36.63 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS | |
| IL-1/IL1-BETA/IL1F2 | |
| IL1B | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3553 | |
| IL1B (Human) Recombinant Protein (Q01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| IL1B | |
| Human | |
| Recombinant | |
| Solution |