missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LPPR2 Antibody [Unconjugated], Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP3-43685-100ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
LPPR2 Polyclonal antibody specifically detects LPPR2 in Human samples. It is validated for Immunohistochemistry,Immunohistochemistry (Paraffin)
Spezifikation
| LPPR2 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| DKFZp761E1121, EC 3.1.3.4, FLJ13055, lipid phosphate phosphatase-related protein type 2, plasticity related gene 4, Plasticity-related gene 4 protein, PRG4, PRG-4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAA | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 64748 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur