missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAPK1IP1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65 € - 509.25 €
Spezifikation
| Antigen | MAPK1IP1L |
|---|---|
| Verdünnung | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Anwendungen | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18425041
|
Novus Biologicals
NBP1-88420-25ul |
25 μL |
 415.00 € 391.65 € / 25 Mikroliter Sparen 23.35 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18279977
|
Novus Biologicals
NBP1-88420 |
0.1 mL |
539.00 € 509.25 € / 0.10 Milliliter Sparen 29.75 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
MAPK1IP1L Polyclonal specifically detects MAPK1IP1L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| MAPK1IP1L | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 93487 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| c14_5346, C14orf32, chromosome 14 open reading frame 32, MAPK-interacting and spindle-stabilizing protein, MAPK-interacting and spindle-stabilizing protein-like, MGC23138, MISS, mitogen activated protein kinase 1 interacting protein 1-like, mitogen-activated protein kinase 1 interacting protein 1-like, Mitogen-activated protein kinase 1-interacting protein 1-like | |
| MAPK1IP1L | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.