missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NFE2L2 (Human) Recombinant Protein

Human NFE2L2 partial ORF ( AAH11558, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00004780-Q01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16161875

  • 341.70 € / 10 Mikrogramm
Voraussichtliches Versanddatum: 24-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA
Spezifikation

Spezifikation

AAH11558
nuclear factor (erythroid-derived 2)-like 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NFE2L2
GST
4780
Wheat germ expression system
10 μg
NRF2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote