missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ NFE2L2 (Human) Recombinant Protein
Human NFE2L2 partial ORF ( AAH11558, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00004780-Q01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
- Sequence: FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA
Spezifikation
| AAH11558 | |
| nuclear factor (erythroid-derived 2)-like 2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NFE2L2 | |
| GST |
| 4780 | |
| Wheat germ expression system | |
| 10 μg | |
| NRF2 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |