missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCNA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-89503
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
PCNA Polyclonal antibody specifically detects PCNA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Spezifikation
| PCNA | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| cyclin, DNA polymerase delta auxiliary protein, MGC8367, proliferating cell nuclear antigen | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCA | |
| 0.1 mL | |
| Autophagy, Base Excision Repair, Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, DNA Polymerases, DNA Repair, Loading Controls, Phospho Specific, Stem Cell Markers | |
| 5111 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?