missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pea3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
214.00 € - 584.00 €
Spezifikation
| Antigen | Pea3 |
|---|---|
| Verdünnung | Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Anwendungen | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
30229578
|
Novus Biologicals
NBP3-35390-100ul |
100 μL |
584.00 €
100 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
30228856
|
Novus Biologicals
NBP3-35390-20ul |
20 μL |
214.00 €
20 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
Pea3 Polyclonal antibody specifically detects Pea3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpezifikation
| Pea3 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.3), 50% glycerol | |
| 2118 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Adenovirus E1A enhancer-binding protein, E1A-FE1A enhancer binding protein, E1AFETS translocation variant 4, ets variant 4, ets variant gene 4 (E1A enhancer binding protein, E1AF), ets variant gene 4 (E1A enhancer-binding protein, E1AF), EWS protein/E1A enhancer binding protein chimera, PEA3, PEAS3, Polyomavirus enhancer activator 3 homolog, polyomavirus enhancer activator-3, Protein PEA3 | |
| Recombinant Protein corresponding to a sequence within amino acids 1-284 of human Pea3 (NP_001977.1).,, Sequence:, KNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts