missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protein kinase-like protein SgK493 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-80758
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Protein kinase-like protein SgK493 Polyclonal antibody specifically detects Protein kinase-like protein SgK493 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| Protein kinase-like protein SgK493 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q504Y2 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| EC 2.7, FLJ18197, MGC125960, protein kinase domain containing, cytoplasmic homolog (mouse), protein kinase domain-containing protein, cytoplasmic, Protein kinase-like protein SgK493, SgK493, Sugen kinase 493, Vertebrate lonesome kinase, Vlk | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTT | |
| 0.1 mL | |
| Protein Kinase | |
| 91461 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur