missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protein kinase-like protein SgK493 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 572.00 €
Spezifikation
| Antigen | Protein kinase-like protein SgK493 |
|---|---|
| Verdünnung | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18476240
|
Novus Biologicals
NBP1-80758 |
0.1 mL |
572.00 €
0.10 Milliliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18468070
|
Novus Biologicals
NBP1-80758-25ul |
25 μL |
433.00 €
25 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
Protein kinase-like protein SgK493 Polyclonal antibody specifically detects Protein kinase-like protein SgK493 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| Protein kinase-like protein SgK493 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol | |
| EC 2.7, FLJ18197, MGC125960, protein kinase domain containing, cytoplasmic homolog (mouse), protein kinase domain-containing protein, cytoplasmic, Protein kinase-like protein SgK493, SgK493, Sugen kinase 493, Vertebrate lonesome kinase, Vlk | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Q504Y2 | |
| 91461 | |
| IgG | |
| Immunogen affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts