missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant other Ag85B Protein
A cDNA sequence encoding the Ag85B was constructed and used to recombinantly synthesize the protein.
Marke: enQuireBio™ QP10977-10ug
Weitere Details : Netto-Gewicht : 0.01000kg
Spezifikation
| 885785 | |
| 10 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Recombinant Protein | |
| E. coli | |
| MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG | |
| Greater than 90.0% as determined by SDS-PAGE. |
| Ag85B Protein | |
| Research Use Only | |
| fbpB | |
| Other | |
| His | |
| Lyophilized with 0.1% glycerol. |