missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant other Ag85B Protein
A cDNA sequence encoding the Ag85B was constructed and used to recombinantly synthesize the protein.
Marke: enQuireBio™ QP10977-10ug
Weitere Details : Netto-Gewicht : 0.01000kg
Spezifikation
885785 | |
10 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Recombinant Protein | |
E. coli | |
MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG | |
Greater than 90.0% as determined by SDS-PAGE. |
Ag85B Protein | |
Research Use Only | |
fbpB | |
Other | |
His | |
Lyophilized with 0.1% glycerol. |