missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SCGB2A2 (Human) Recombinant Protein
Human SCGB2A2 full-length ORF ( AAI28403.1, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00004250-P01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
- Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Spezifikation
| AAI28403.1 | |
| secretoglobin, family 2A, member 2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SCGB2A2 | |
| GST |
| 4250 | |
| Wheat germ expression system | |
| 10 μg | |
| MGB1, MGC71974, UGB2 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |