missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCYL1BP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP3-35737-20ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
SCYL1BP1 Polyclonal antibody specifically detects SCYL1BP1 in Human,Mouse samples. It is validated for ELISA,Western Blot
Spezifikation
| SCYL1BP1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| FLJ11752, golgin, RAB6-interacting, GONTKL-binding protein 1, hNTKL-BP1, MGC51263, MGC70512, N-terminal kinase-like-binding protein 1, NTKL-BP1, NTKLBP1SCY1-like 1-binding protein 1, RAB6-interacting golgin, SCY1-like 1 binding protein 1, SCYL1-BP1, SCYL1BP1SCYL1-binding protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SCYL1BP1 (NP_001139511.1).,, Sequence:, MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV | |
| 20 μL | |
| Primary | |
| Human, Mouse | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 92344 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur