missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIM23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marke: Novus Biologicals NBP1-88846
Artikelnummer. 18208367
-
725.00 €
685.65 € / 0.10 Milliliter
Sparen 39.35 €
5% Rabatt
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
TRIM23 Polyclonal specifically detects TRIM23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.
Spezifikation
| TRIM23 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ADP-ribosylation factor domain protein 1, 64kDa, ADP-ribosylation factor domain-containing protein 1, ARD1GTP-binding protein ARD-1, ARF domain protein 1, ARFD1, E3 ubiquitin-protein ligase TRIM23, EC 6.3.2.-, RNF46RING finger protein 46, tripartite motif containing 23, tripartite motif protein TRIM23, tripartite motif-containing 23, Tripartite motif-containing protein 23 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TRIM23 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST | |
| 0.1 mL | |
| Signal Transduction, Zinc Finger | |
| 373 | |
| Human | |
| IgG |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?
For Research Use Only