missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ubiquitin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-58398-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Ubiquitin Polyclonal specifically detects Ubiquitin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| Ubiquitin | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| RPS27A, UBA52, UBB ubiquitin B, UBC | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| RPS27A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED | |
| 25 μL | |
| Alzheimers Research, Autophagy, Cancer, Membrane Trafficking and Chaperones, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Protein Turnover, Ubiquitin Proteasome Pathway | |
| 6233 | |
| Human | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering