missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ubiquitin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.00 € - 568.00 €
Spezifikation
| Antigen | Ubiquitin |
|---|---|
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18223215
|
Novus Biologicals
NBP2-58398 |
100 μL |
568.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18623247
|
Novus Biologicals
NBP2-58398-25ul |
25 μL |
391.00 €
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Ubiquitin Polyclonal specifically detects Ubiquitin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| Ubiquitin | |
| Polyclonal | |
| Rabbit | |
| Alzheimers Research, Autophagy, Cancer, Membrane Trafficking and Chaperones, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Protein Turnover, Ubiquitin Proteasome Pathway | |
| RPS27A, UBA52, UBB ubiquitin B, UBC | |
| RPS27A | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 6233 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts