missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AP2B1 Partial ORF (NP_001273.1, 585 a.a. - 651 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00000163-Q01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16184434

  • 467.00 € / 25 Mikrogramm

Verfügbar ab
05-01-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

Sequence: SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
Spezifikation

Spezifikation

NP_001273.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.11kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
RUO
AP2B1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
163
AP2B1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ADTB2|AP105B|AP2-BETA|CLAPB1|DKFZp781K0743
AP2B1
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation