missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COQ2 Partial ORF (NP_056512.3, 84 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00027235-Q01.10ug

Weitere Details : Netto-Gewicht : 0.02000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16075415

  • 335.00 € / 10 Mikrogramm
Verfügbar ab: 04-04-2024
Sie sich ein, um den Lagerbestand zu sehen

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]

Sequence: AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK
Spezifikation

Spezifikation

NP_056512.3
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.13kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK
RUO
COQ2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
27235
COQ2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CL640/FLJ26072
COQ2
Recombinant
wheat germ expression system
Empfehlungen

Empfehlungen

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote