missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COQ2 Partial ORF (NP_056512.3, 84 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00 € - 508.00 €

Spezifikation

Zugriffsnummer NP_056512.3
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 27235
Molekulargewicht 31.13kDa
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16075415
Unterlagen ansehen Aktionsdetails
Abnova™
H00027235-Q01.10UG
10 ug
335.00 €
10 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab: 02-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
16085415
Unterlagen ansehen Aktionsdetails
Abnova™
H00027235-Q01.25UG
25 ug
508.00 €
25 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab: 02-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Beschreibung

Beschreibung

CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]

Sequence: AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK
Spezifikation

Spezifikation

NP_056512.3
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.13kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CL640/FLJ26072
COQ2
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
27235
COQ2 (Human) Recombinant Protein (Q01)
AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK
RUO
COQ2
Wheat Germ (in vitro)
GST
Liquid
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Produktzertifizierungen