missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human RERE Partial ORF (NP_036234.2, 85 a.a. - 193 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00000473-Q01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNVKWYYRQSEVSpezifikation
| NP_036234.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.73kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNVKWYYRQSEV | |
| RUO | |
| RERE | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 473 | |
| RERE (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ARG/ARP/ATN1L/DNB1/FLJ38775/KIAA0458 | |
| RERE | |
| Recombinant | |
| wheat germ expression system |