Learn More
Abnova™ Human RPS3A Partial ORF (NP_000997, 164 a.a. - 263 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00006189-Q01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ribosomal proteins. It is located in the cytoplasm. Disruption of the gene encoding rat ribosomal protein S3a, also named v-fos transformation effector protein, in v-fos-transformed rat cells results in reversion of the transformed phenotype. Transcript variants utilizing alternative transcription start sites have been described. This gene is co-transcribed with the U73A and U73B small nucleolar RNA genes, which are located in its fourth and third introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]
Sequence: IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQESSpezifikation
NP_000997 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQES | |
RUO | |
RPS3A | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
6189 | |
RPS3A (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FTE1/MFTL/MGC23240 | |
RPS3A | |
Recombinant | |
wheat germ expression system |