missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC4A1 Partial ORF (NP_000333.1, 261 a.a. - 360 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00006521-Q01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16165385

  • 341.70 € / 10 Mikrogramm
Voraussichtliches Versanddatum: 24-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

The protein encoded by this gene is part of anion exchanger family and is expressed in erythrocyte plasma mem, where it functions as a chloride/bicarbonate exchanger involved in CO2 transport from tissues to lungs. The protein comprises 2 distinct domains. The N-terminal 40kDa domain is located in cytoplasm and acts as an attachment site for red cell skeleton by binding ankyrin. The glycosylated C-terminal memb-associated domain contains 12-14 memb spanning segments and carries out stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the memb domain binds carbonic anhydrase II. The encoded protein associates with the red cell memb protein glycophorin A which promotes the correct folding and translocation of the exchanger. This protein is predominantly dimeric but forms tetramers in the presence of ankyrin. Many mutations in this gene are known in man, lead to 2 types of disease: destabilization of red cell membrane leading to hereditary spherocytosis, and defective kidney acid secretion leading to distal renal tubular acidosis. Other mutations that do not give rise to disease result in novel blood group antigens, which form the Diego blood group system. Southeast Asian ovalocytosis results from heterozygous presence of a deletion in the encoded protein and is common in areas where Plasmodium falciparum malaria is endemic. One null mutation in this gene is known, resulting in very severe anemia and nephrocalcinosis.

Sequence: PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK
Spezifikation

Spezifikation

NP_000333.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK
RUO
SLC4A1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6521
SLC4A1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AE1/BND3/CD233/DI/EMPB3/EPB3/FR/MGC116750/MGC116753/MGC126619/MGC126623/RTA1A/SW/WD/WD1/WR
SLC4A1
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote