missing translation for 'onlineSavingsMsg'
Learn More

LOC124220 Recombinant Protein, Abnova

Recombinant protein for LOC124220 (human) gene

Marke:  Abnova H00124220-P01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16167573

  • 320.54 € / 10 Mikrogramm

Voraussichtliches Versanddatum: 13-12-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Human LOC124220 full-length ORF ( AAH09722, 18 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal
  • Theoretical molecular weight: 42.79kDa
  • Preparation: in vitro wheat germ expression system
  • Purification: glutathione sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer

Sequence: KMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

Best use within three months from the date of receipt.

ELISA, western blotting (recombinant protein), antibody production, protein array

Spezifikation

Spezifikation

AAH09722
Solution
124220
LOC124220 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LOC124220
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
43.2
8
Glutathione Sepharose 4 Fast Flow
10 ug
KMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
HRPE773/PRO1567
LOC124220
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate