missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NANS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 550.00 €
Spezifikation
| Antigen | NANS |
|---|---|
| Verdünnung | Western Blot 1:500 - 1:2000, ELISA |
| Anwendungen | ELISA, Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
30226901
|
Novus Biologicals
NBP3-38112-100ul |
100 μL |
550.00 €
100 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
30227931
|
Novus Biologicals
NBP3-38112-20ul |
20 μL |
190.00 €
20 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
NANS Polyclonal antibody specifically detects NANS in Human samples. It is validated for ELISA,Western BlotSpezifikation
| NANS | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| metabolism, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 54187 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 2.5.1.56, EC 2.5.1.57, N-acetylneuraminate synthase, N-acetylneuraminate-9-phosphate synthase, N-acetylneuraminic acid phosphate synthase, N-acetylneuraminic acid synthasesialic acid phosphate synthase, SASsialic acid synthase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 260-359 of human NANS (NP_061819.2).,, Sequence:, AELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts