missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human MOG Protein
A cDNA sequence encoding the MOG was constructed and used to recombinantly synthesize the protein.
Marke: enQuireBio™ QP12718-50ug
Weitere Details : Netto-Gewicht : 0.01000kg
Spezifikation
| MOG Protein | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH | |
| Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| 50 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Human | |
| His | |
| The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride. |