missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human MOG Protein

A cDNA sequence encoding the MOG was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP12718-1mg

Weitere Details : Netto-Gewicht : 0.01000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 15901329

  • 2000.00 € / 1 Milligramm
Verfügbar ab: 30-01-2023
Sie sich ein, um den Lagerbestand zu sehen

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

Spezifikation

Spezifikation

MOG Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride.
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote