missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat CNTF Protein

A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP10559-25ug

Weitere Details : Netto-Gewicht : 0.01000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 15924248

Menge Preis
1 194.62 € / 25 Mikrogramm
10 182.86 € / 25 Mikrogramm
Voraussichtliches Versanddatum: 17-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!



Beschreibung

Beschreibung

Spezifikation

Spezifikation

CNTF Protein
25 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Research Use Only
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Rat
Untagged
Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3.
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote