missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SUB1 (Human) Recombinant Protein
Human SUB1 partial ORF ( AAH09610.1, 32 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00010923-Q01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Description
- Sequence: APEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAV
Spécification
| AAH09610.1 | |
| SUB1 homolog (S. cerevisiae) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SUB1 | |
| GST |
| 10923 | |
| Wheat germ expression system | |
| 10 μg | |
| MGC102747, P15, PC4, p14 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |