missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GPR62 Partial ORF (NP_543141, 314 a.a. - 368 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70 € - 518.16 €

Spezifikation

Name GPR62 (Human) Recombinant Protein (Q01)
Rekombinant Yes
Zur Verwendung mit (Anwendung) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molekulargewicht 31.79kDa
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16161597
Unterlagen ansehen Aktionsdetails
Abnova™
H00118442-Q01.25UG
25 ug
518.16 €
25 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 24-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
16151597
Unterlagen ansehen Aktionsdetails
Abnova™
H00118442-Q01.10UG
10 ug
341.70 €
10 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 24-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Beschreibung

Beschreibung

G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM]

Sequence: RACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQGPPESSLS
Spezifikation

Spezifikation

GPR62 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
31.79kDa
Sicherheitsdatenblatt (SDS)
Produktzertifizierungen