missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human IMPG2 Partial ORF (NP_057331.2, 572 a.a. - 678 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Spezifikation
Zugriffsnummer | NP_057331.2 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 50939 |
Molekulargewicht | 37.51kDa |
Code produit | Marque | Menge | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Menge | Prix | Quantité et disponibilité | |||||
16166506
|
Abnova™
H00050939-Q01.25UG |
25 ug |
508.00 €
25 Mikrogramm |
Verfügbar ab: 18-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
16156506
|
Abnova™
H00050939-Q01.10UG |
10 ug |
335.00 €
10 Mikrogramm |
Verfügbar ab: 18-06-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
Description
Interphotoreceptor matrix proteoglycan-2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye.[supplied by OMIM]
Sequence: LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPESpécification
NP_057331.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.51kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
IPM200/SPACRCAN | |
IMPG2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
50939 | |
IMPG2 (Human) Recombinant Protein (Q01) | |
LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPE | |
RUO | |
IMPG2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |