accessibility menu, dialog, popup

UserName
Bio Techne logo

Bio Techne

Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.

Top Categories

Antibodies

Antibodies are essential tools for biomedical research as they allow researchers to identify specific proteins or molecules. Our catalog of over 425,000 antibodies from our R&D Systems™ and Novus Biologicals™ brands have been validated for specificity and reproducibility in over 25 species for more than 15 applications, ensuring that you will find one for your research needs.

Find Your Antibodies
Antibodies

Cell Culture Reagents and Assays

Your unique cell cultures require a consistent foundation whether you are using classical or specialty media, sera, supplements, and matrices. Thorough cell characterization is also critical to determine if the phenotype is what you need for your particular application.

Find Your Cell Culture Reagents
Cell Culture Reagents and Assays

ELISA Kits

Have confidence in your results with R&D Systems™ rigorously validated and tested ELISA kits. As the most published ELISA supplier, with more than 30 years of experience designing and optimizing quantitative immunoassays, you can trust that you have publishable, reproducible data every time.

Find Your ELISA Kits
ELISA Kits

Fluorescent Dyes and Probes

Fluorescent and bioluminescent reagents enable highly sensitive and selective visualization of biological events, from single molecule tracking in vitro through to in vivo imaging. Discover our exclusive range of fluorescent probes, indicators, dyes, and stains.

Find Your Dyes and Probes
Fluorescent Dyes and Probes

Recombinant Proteins

Bio-Techne offers over 5,000 R&D Systems™ bioactive recombinant proteins spanning 35 species and multiple research areas. Our portfolio includes cytokines and growth factors, proteins for studying immuno-oncology targets, enzymes, and animal-free and GMP-grade proteins, as well as custom protein development services and more.

Find Your Recombinant Proteins
Recombinant Proteins

Small Molecules and Peptides

Small molecules and peptides can be used in all stages of biological and biomedical research. Bio-Techne’s unique collection of small molecules and peptides includes high quality, novel, and innovative compounds such as enzyme inhibitors, ion channel modulators, GPCR agonists and antagonists, fluorescent probes and dyes, and molecular biology tools.

Find Your Small Molecules
Small Molecules and Peptides

Related Resources

Optimizing Organoid Culture Conditions:
Optimizing Organoid Culture Conditions
An application note demonstrating the value of R&D Systems™ proteins for achieving robust, reproducible organoid culture conditions
Filename
23227_bio_techne_optimizing_organoids_Fisherised_v2.pdf
Size
1 MB
Format
application/pdf
Realize Your Protein and Cell Potential
Realize Your Protein and Cell Potential
Realize your protein and cell potential
Filename
23227_bio_techne_realize_protein_Fisherised.pdf
Size
3 MB
Format
application/pdf
Organ-on-a-Chip Technology:
Organ-on-a-Chip Technology
Progress, challenges, and an exciting future
Filename
23227_bio_techne_organ_on_a_chip_technology_progress_Fisherised.pdf
Size
326 KB
Format
application/pdf

Fisher Scientific Europe Announces a New Distribution Agreement with Bio-Techne in Europe

Paris, France 01-05-2024

 

Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.

This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.

"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."

Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.

"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."

This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.

About Bio-Techne

Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.

 

Questions? Reach Out to a Specialist >

 

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)

special programs

  • (6,776)

Conjugate

  • (3)
  • (19,060)
  • (7)
  • (2,819)
  • (5)
  • (8)
  • (17)
  • (20,861)
  • (21,143)
  • (21,064)
  • (22,215)
  • (20,879)
  • (21,133)
  • (21,112)
  • (20,847)
  • (7)
  • (261)
  • (2)
  • (3)
  • (2)
  • (3)
  • (2)
  • (1)
  • (1)
  • (4)
  • (26,984)
  • (14,841)
  • (5)
  • (4)
  • (2)
  • (2)
  • (2)
  • (26,829)
  • (26,820)
  • (26,797)
  • (11)
  • (26,818)
  • (26,612)
  • (30)
  • (14)
  • (26,742)
  • (26,806)
  • (26,826)
  • (39)
  • (25,568)
  • (115)
  • (2)
  • (26,654)
  • (1)
  • (4)
  • (9,947)
  • (25,486)
  • (1,696)
  • (1,695)
  • (25,436)
  • (9,903)
  • (1)
  • (19,030)
  • (14)
  • (2,823)
  • (2,834)
  • (2,818)
  • (5)
  • (6)
  • (5)
  • (4)
  • (20,966)
  • (11)
  • (8)
  • (8)
  • (150)
  • (4)
  • (19)
  • (143)
  • (158,025)
  • (114)
  • (18,633)
  • (18,595)
  • (18,593)

Applications

  • (65)
  • (133)
  • (165)
  • (18)
  • (5)
  • (464)
  • (106)
  • (5)
  • (2,165)
  • (658)
  • (1,643)
  • (119)
  • (55)
  • (72)
  • (1)
  • (8)
  • (127)
  • (42,444)
  • (2)
  • (36)
  • (114)
  • (93)
  • (1,621)
  • (365)
  • (272,572)
  • (5,623)
  • (5,512)
  • (5,582)
  • (22)
  • (59)
  • (163,622)
  • (292)
  • (7,669)
  • (3)
  • (6)
  • (309)
  • (7,319)
  • (7)
  • (43)
  • (92)
  • (4,366)
  • (69)
  • (67)
  • (6)
  • (36)
  • (3,040)
  • (1,620)
  • (121,250)
  • (51,927)
  • (337)
  • (38)
  • (163,131)
  • (341,232)
  • (651)
  • (21,541)
  • (24)
  • (278,425)
  • (18)
  • (48)
  • (22)
  • (470)
  • (43,238)
  • (52)
  • (212)
  • (53)
  • (262)
  • (97)
  • (142)
  • (7,267)
  • (99)
  • (8)
  • (6)
  • (137)
  • (5)
  • (134)
  • (967)
  • (2)
  • (10,630)
  • (1)
  • (18)
  • (3)
  • (1,320)
  • (93)
  • (6,993)
  • (324)
  • (2)
  • (3)
  • (7)
  • (444)
  • (3)
  • (7)
  • (721)
  • (4,308)
  • (135)
  • (142)
  • (2,629)
  • (75)
  • (2)
  • (22)
  • (103)
  • (11)
  • (522,619)
  • (453)
  • (15)

Target Species

  • (20)
  • (28)
  • (129)
  • (12)
  • (1,239)
  • (143)
  • (25)
  • (563)
  • (17)
  • (32)
  • (514)
  • (675)
  • (38)
  • (2,453)
  • (203)
  • (12)
  • (16,375)
  • (740)
  • (1,542)
  • (98)
  • (22)
  • (880)
  • (6)
  • (27)
  • (20,892)
  • (600)
  • (5,174)
  • (267)
  • (349)
  • (566)
  • (141)
  • (2)
  • (4)
  • (21)
  • (1,523)
  • (2)
  • (240)
  • (32)
  • (36)
  • (4)
  • (1,273)
  • (99)
  • (10)
  • (971)
  • (74)
  • (1)
  • (4)
  • (7,055)
  • (78)
  • (2)
  • (2,640)
  • (65)
  • (512)
  • (182)
  • (1)
  • (77)
  • (890)
  • (16)
  • (129)
  • (96)
  • (1,876)
  • (13)
  • (179)
  • (27)
  • (5,959)
  • (93)
  • (230)
  • (176)
  • (149)
  • (127)
  • (107)
  • (2,435)
  • (211)
  • (2)
  • (1)
  • (741,398)
  • (460)
  • (1)
  • (1)
  • (1)
  • (93)
  • (51)
  • (7)
  • (85)
  • (391)
  • (240)
  • (315)
  • (21)
  • (81)
  • (11)
  • (91)
  • (287)
  • (798)
  • (769)
  • (2)
  • (18)
  • (97)
  • (12,173)
  • (65)
  • (2)
  • (292,538)
  • (3,487)
  • (1)
  • (15)
  • (299)
  • (8)
  • (47)
  • (3,217)
  • (24)
  • (2)
  • (216)
  • (43)
  • (168)
  • (35)
  • (128)
  • (11,779)
  • (29)
  • (549)
  • (225)
  • (447)
  • (12,863)
  • (75)
  • (237)
  • (2)
  • (10,097)
  • (312)
  • (197,851)
  • (3,919)
  • (1)
  • (204)
  • (326)
  • (9)
  • (20)
  • (22)
  • (145)
  • (27)
  • (5)
  • (667)
  • (2,805)
  • (2,853)
  • (207)
  • (6)
  • (44)
  • (13)
  • (75)
  • (523)
  • (47)
  • (7)
  • (1,013)
  • (10,879)
  • (25)
  • (36)
  • (138)
  • (1,492)
  • (1,374)
  • (3,845)

Classification

  • (453,250)
  • (380,655)

Host Species

  • (956)
  • (23)
  • (8)
  • (1,466)
  • (632)
  • (17)
  • (2)
  • (23,267)
  • (44)
  • (50)
  • (420)
  • (9,338)
  • (34)
  • (30)
  • (335,138)
  • (1)
  • (28)
  • (5)
  • (415,570)
  • (30,503)
  • (15,563)
  • (1)
  • (1)

Quantity

  • (1)
  • (2)
  • (1)
  • (3,056)
  • (932)
  • (2,699)
  • (4,375)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,384)
  • (3,328)
  • (667,833)
  • (16,787)
  • (9)
  • (825)
  • (64)
  • (1)
  • (8)
  • (1)
  • (3,726)
  • (792)
  • (1,240)
  • (192)
  • (1)
  • (5)
  • (1)
  • (6,221)
  • (576)
  • (1)
  • (3)
  • (3)
  • (7)
  • (24)
  • (1)
  • (2,057)
  • (1,904)
  • (2)
  • (70)
  • (1)
  • (17)
  • (1)
  • (30)
  • (3)
  • (1)
  • (123)
  • (25,656)
  • (47,834)
  • (1)
  • (1)
  • (49)
  • (4)
  • (2)
  • (7)
  • (10)
  • (6)
  • (36)
  • (1)
  • (4)
  • (1)
  • (1)
  • (1)
  • (1)
  • (15)
  • (1)
  • (2)
  • (1)
  • (7)
  • (51)
  • (342)
  • (3,589)
  • (4,029)
  • (5)
  • (64)
  • (97)
  • (150)
  • (1)
  • (2)
  • (1)
  • (1)
  • (16,813)
  • (2,075)
  • (1)
  • (7)
  • (14)
  • (7)
  • (86)
  • (5)
  • (1)
  • (2,135)
  • (5)
  • (198)
  • (1)
  • (7)
  • (1)
  • (3)
  • (1)
  • (4)
  • (14)
  • (525)
  • (9)
  • (2)
  • (13)
  • (889)
  • (8,310)
  • (1)
  • (3)
  • (2)
  • (7)
  • (38)
  • (705)
  • (1)
  • (35)
  • (6)
  • (1)
  • (1)
  • (9)
  • (15)
  • (1)
  • (662)
  • (5)
  • (8)

Isotype

  • (99)
  • (55)
  • (25)
  • (1)
  • (43)
  • (2)
  • (2)
  • (436,428)
  • (21,262)
  • (502)
  • (140,494)
  • (60,402)
  • (752)
  • (28)
  • (50)
  • (7,233)
  • (235)
  • (1,873)
  • (124)
  • (54,421)
  • (17,642)
  • (533)
  • (35)
  • (53,476)
  • (18,216)
  • (588)
  • (4)
  • (23)
  • (570)
  • (1,862)
  • (27)
  • (1,796)
  • (1,215)
  • (44)
  • (906)
  • (153)
  • (33)
  • (431)
  • (290)
  • (33)
  • (1,071)
  • (17)

Regulatory Status

  • (761,649)

Form

  • (889)
  • (812)
  • (20)
  • (1)
  • (1)
  • (4,074)
  • (2,378)
  • (4)
  • (160)
  • (690,958)
  • (4)
  • (1)
  • (2)
  • (750)
  • (1)

For Use With (Application)

  • (2,709)
  • (1,920)
  • (8)
  • (2)
  • (4)
  • (2)
  • (1)
  • (1)
  • (25)
  • (305)
  • (20,281)
  • (2)
  • (4)
  • (37)
  • (48)
  • (99)
  • (1)
  • (3)
  • (30)
  • (25)
  • (7)
  • (3)
  • (10)
  • (546)
  • (19,643)
  • (8)
  • (34)
  • (20)
  • (67)
  • (235)
  • (562)
  • (9)
  • (322)
  • (16)
  • (2)
  • (78)
  • (141)
  • (88)
  • (1)
  • (68)
  • (1)
  • (11)
  • (1)
  • (4)
  • (4,210)
  • (4)
  • (3)
  • (19,551)
  • (6)
  • (1)
  • (6,296)
  • (4)
  • (2)
  • (5)
  • (1)
  • (3)
  • (1)
  • (19,922)
  • (5)
  • (1)

1 – 15 of 952,097 results
1

Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG1 κ
Gene Accession No. Q14674
Research Discipline Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators
Concentration 0.9 mg/mL
Antigen Separase
Gene Symbols ESPL1
Regulatory Status RUO
Purification Method Protein G purified
Dilution Western Blot 1:500
Gene Alias Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase
Gene ID (Entrez) 9700
Immunogen Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674]
Classification Monoclonal
Primary or Secondary Primary
Clone XJ11-1B12
3

Novus Biologicals Recombinant Human alpha-Synuclein Active, Pre-formed Fibrils, (Type 1), A53T Mutant Protein

Purity or Quality Grade >95%, by SDS-PAGE
Gene Alias alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein
Gene ID (Entrez) 6622
Formulation PBS pH 7.4
Gene Symbol SNCA
Research Category Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
Storage Requirements Store at -80C. Avoid freeze-thaw cycles.
For Use With (Application) Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Protein alpha-Synuclein
4

Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

5

53BP1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Gene Symbols TP53BP1
Gene Alias 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1
6

Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™

Mouse Monoclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Bacteria
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,ELISA
Form Purified
Isotype IgG1 κ
Concentration 1 mg/mL
Antigen Listeria monocytogenes p60
Regulatory Status RUO
Purification Method Protein G purified
Dilution Western Blot, ELISA
Gene Alias IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein
Formulation 0.2um-filtered solution in PBS, pH 7.4.
Immunogen Recombinant Listeria monocytogenes p60.
Classification Monoclonal
Primary or Secondary Primary
Test Specificity Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species.
Clone p6007
7

RWDD4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen RWDD4A
Gene Symbols RWDD4
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A
Gene ID (Entrez) 201965
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
10

CaMKII alpha/beta, p Thr286, p Thr287 Antibody (22B1), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 4 publications

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG1
Gene Accession No. P11275
Research Discipline Phospho Specific, Wnt Signaling Pathway
Concentration 1 mg/mL
Antigen CaMKII alpha/beta (p Thr286, p Thr287)
Gene Symbols CAMK2A
Regulatory Status RUO
Purification Method Protein G purified
Dilution Western Blot 1 μg/mL, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunoblotting
Gene Alias calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha, calcium/calmodulin-dependent protein kinase II alpha, calcium/calmodulin-dependent protein kinase II alpha-B subunit, CaM kinase II alpha subunit, CaM kinase II subunit alpha, CAMKAcalcium/calmodulin-dependent protein kinase type II subunit alpha, CaMK-II alpha subunit, CaMK-II subunit alpha, CaMKIINalpha, CaM-kinase II alpha chain, EC 2.7.11, EC 2.7.11.17, KIAA0968calcium/calmodulin-dependent protein kinase type II alpha chain
Gene ID (Entrez) 815
Immunogen Synthetic peptide
Classification Monoclonal
Primary or Secondary Primary
Test Specificity This antibody is specific for a and B subunits of CaMKII only when they are phosphorylated at Thr-286/287 (in B).
Clone 22B1
11

Novus Biologicals™ Fluorescent Exosome Standards (HCT116 cell line)

Highly pure, lyophilized exosome standards with superior stability, optimal for multiple applications

14

NOX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 23 publications

15

Peripheral Node Addressin Antibody (MECA-79R) - BSA Free, Novus Biologicals™

Rat Monoclonal Antibody has been used in 19 publications

Content And Storage Store at -20°C.
Target Species Human,Mouse
Host Species Rat
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen),In vitro Assay
Form Purified
Isotype IgG1
Research Discipline Lipid and Metabolism
Concentration 1 mg/mL
Antigen Peripheral Node Addressin
Purification Method Protein A or G purified
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:100-1:500, Immunocytochemistry/Immunofluorescence reported in scientific literature (PMID 31278331), Immunohistochemistry-Paraffin 1:100-1:500, Immunohistochemistry-Frozen 1:100-1:500, In vivo assay reported in scientific literature (PMID 30277476)
Gene Alias MECA-79, Peripheral Node Addressin, PNAd
Formulation PBS with 0.02% Sodium Azide
Immunogen Mouse lymph node stromal cells
Classification Monoclonal
Primary or Secondary Primary
Clone MECA-79R

Bio Techne